PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK00339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 326aa    MW: 36748 Da    PI: 5.0941
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK00339.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.16.9e-5361341128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv +yLk+kveg ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd++v++++g+
  PK00339.1   6 LPPGFRFHPTDEELVGYYLKRKVEGLEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDRKVVCQSGS 104
                79****************************.99**************95344555788****************************************** PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++  +ktLvfy grap g +tdW+mheyrl
  PK00339.1 105 VTAYRKTLVFYCGRAPLGDRTDWIMHEYRL 134
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-604157IPR003441NAC domain
PROSITE profilePS5100557.7126157IPR003441NAC domain
PfamPF023651.0E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELV GYYLKRKVEG LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWFFFCPR DRKYPNGSRT NRATKAGYWK ATGKDRKVVC QSGSVTAYRK TLVFYCGRAP  120
LGDRTDWIMH EYRLSDDFTQ GAPSFHGGYA LCRVVKKNEN GQKLNDWLGE PKGKKIGSSS  180
SNGGLILNEP LGINSGEASS HASRYSSPIM SPNEVTPVSD FEPSVTQTNP ASFWVSPDLI  240
LDSSKDYPQL QAAIPDYFGQ YECPSSSMTP WQSYHEHTEI SPSSSYSNLN GGIELSDTSY  300
MDFYGNEVME YEGYGQTNSM SYMQPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-54516316171NAC domain-containing protein 19
4dul_A3e-54516316171NAC domain-containing protein 19
1ut7_B3e-54516316171NO APICAL MERISTEM PROTEIN
1ut7_A3e-54516316171NO APICAL MERISTEM PROTEIN
1ut4_B3e-54516316171NO APICAL MERISTEM PROTEIN
1ut4_A3e-54516316171NO APICAL MERISTEM PROTEIN
3swp_D3e-54516319174NAC domain-containing protein 19
3swp_C3e-54516319174NAC domain-containing protein 19
3swp_B3e-54516319174NAC domain-containing protein 19
3swp_A3e-54516319174NAC domain-containing protein 19
3swm_D3e-54516319174NAC domain-containing protein 19
3swm_C3e-54516319174NAC domain-containing protein 19
3swm_B3e-54516319174NAC domain-containing protein 19
3swm_A3e-54516319174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104346.11e-180NAC domain-containing protein 74
TrEMBLW9SCT91e-180W9SCT9_9R
STRINGGLYMA17G16500.21e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67223450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-108NAC domain containing protein 71